Recombinant Macaca fascicularis tumor-associated calcium signal transducer 2 (TACSTD2), partial (Active)

In Stock
Code: CSB-MP6581MOV
Size:
20ug
20ug100ug1mg
US$102
Quantity:
Express system: Mammalian cell
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Cynomolgus monkey TACSTD2 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/mL can bind Anti-TACSTD2 recombinant antibody(CSB-RA023072MA1HU) The EC50 is 1.720-2.009 ng/mL.
Target Names
TACSTD2
Uniprot NO.
Alternative Names
/
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
31-274aa
Target Protein Sequence
QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTASAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis TACSTD2 at 2 μg/ml can bind Anti-TACSTD2 recombinant antibody(CSB-RA023072MA1HU) The EC50 is 1.720-2.009 ng/mL.
  • TACSTD2 Recombinant Monoclonal Antibody (CSB-RA023072MA1HU) captured on Protein A Chip can bind Recombinant Cynomolgus monkey TACSTD2 protein with an affinity constant of 0.135 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description

TACSTD2 functions as a cell surface marker overexpressed in numerous epithelial cancers, where it mediates intracellular calcium signaling and promotes tumor cell proliferation and metastasis. This recombinant protein spans residues 31–274, capturing the complete extracellular domain required for antibody recognition and receptor interactions, and demonstrates robust binding activity with an EC50 of 1.720–2.009 ng/mL against a validated anti-TACSTD2 antibody in functional ELISA. The quantified binding kinetics support its use in antibody development and validation workflows, including epitope mapping and affinity maturation studies targeting TACSTD2-positive tumors. Mammalian cell expression ensures native glycosylation and disulfide bond formation critical for authentic epitope presentation, while purity exceeding 95% and endotoxin levels below 1.0 EU/μg align with standards expected in cell-based assays investigating tumor cell adhesion, migration, and immune cell trafficking in cancer metastasis models.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products